Anti-LARP4
Artikelnummer:
ATA-HPA039306
- Bilder (8)
| Artikelname: | Anti-LARP4 |
| Artikelnummer: | ATA-HPA039306 |
| Hersteller Artikelnummer: | HPA039306 |
| Alternativnummer: | ATA-HPA039306-100,ATA-HPA039306-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PP13296 |
| La ribonucleoprotein domain family, member 4 |
| Anti-LARP4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 113251 |
| UniProt: | Q71RC2 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KTNAAAMNMGRPFQKNRVKPQFRSSGGSEHSTEGSVSLGDGQLNRYSSRNFPAERHNPTVTGHQEQTYLQKETSTLQVEQNGDYGRGR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | LARP4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LARP4 antibody. Remaining relative intensity is presented. |
|
|
HPA039306-100ul |
|
|
|
|
|
|
|
|
HPA039306-100ul |
|
|
HPA039306-100ul |
Produktgarantie und fachkundiger Support
