Anti-DNAJC3
Artikelnummer:
ATA-HPA039336
- Bilder (6)
| Artikelname: | Anti-DNAJC3 |
| Artikelnummer: | ATA-HPA039336 |
| Hersteller Artikelnummer: | HPA039336 |
| Alternativnummer: | ATA-HPA039336-100,ATA-HPA039336-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HP58, P58, P58IPK, PRKRI |
| DnaJ (Hsp40) homolog, subfamily C, member 3 |
| Anti-DNAJC3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5611 |
| UniProt: | Q13217 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YKISTLYYQLGDHELSLSEVRECLKLDQDHKRCFAHYKQVKKLNKLIESAEELIRDGRYTDATSKYESVMKTEPSIAEYTVR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAJC3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to endoplasmic reticulum. |
|
|
Immunohistochemical staining of human thyroid gland shows cytoplasmic positivity in glandular cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA039336-100ul |
|
|
HPA039336-100ul |
|
|
HPA039336-100ul |
Produktgarantie und fachkundiger Support
