Anti-RASSF9
Artikelnummer:
ATA-HPA039428
- Bilder (7)
| Artikelname: | Anti-RASSF9 |
| Artikelnummer: | ATA-HPA039428 |
| Hersteller Artikelnummer: | HPA039428 |
| Alternativnummer: | ATA-HPA039428-100,ATA-HPA039428-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | P-CIP1, PAMCI |
| Ras association (RalGDS/AF-6) domain family (N-terminal) member 9 |
| Anti-RASSF9 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9182 |
| UniProt: | O75901 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | YELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RASSF9 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-RASSF9 antibody HPA039428 (A) shows similar pattern to independent antibody HPA039678 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA039428-100ul |
|
|
|
|
|
HPA039428-100ul |
|
|
HPA039428-100ul |
Produktgarantie und fachkundiger Support
