Anti-SMCHD1
Artikelnummer:
ATA-HPA039441
- Bilder (9)
| Artikelname: | Anti-SMCHD1 |
| Artikelnummer: | ATA-HPA039441 |
| Hersteller Artikelnummer: | HPA039441 |
| Alternativnummer: | ATA-HPA039441-100,ATA-HPA039441-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0650 |
| structural maintenance of chromosomes flexible hinge domain containing 1 |
| Anti-SMCHD1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23347 |
| UniProt: | A6NHR9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DNGRGMTSKQLNNWAVYRLSKFTRQGDFESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKED |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SMCHD1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human duodenum shows nucelar positivity in glandular cells. |
|
|
Western blot analysis in human cell lines U2OS and MCF-7 using Anti-SMCHD1 antibody. Corresponding SMCHD1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
Western blot analysis in human cell line HL-60. |
|
|
HPA039441-100ul |
|
|
|
|
|
|
|
|
HPA039441-100ul |
|
|
HPA039441-100ul |
Produktgarantie und fachkundiger Support
