Anti-FBXL16
Artikelnummer:
ATA-HPA039504
- Bilder (9)
| Artikelname: | Anti-FBXL16 |
| Artikelnummer: | ATA-HPA039504 |
| Hersteller Artikelnummer: | HPA039504 |
| Alternativnummer: | ATA-HPA039504-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C16orf22, Fbl16, MGC33974 |
| F-box and leucine-rich repeat protein 16 |
| Anti-FBXL16 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 146330 |
| UniProt: | Q8N461 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ILNGLFWYFSACEKCVLAQVCKAWRRVLYQPKFWAGLTPVLHAKELYNVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFIDNYALSKKGVKA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FBXL16 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and rectum tissues using Anti-FBXL16 antibody. Corresponding FBXL16 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human rectum shows low expression as expected. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human Cerebral Cortex tissue |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FBXL16 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407066). |
|
|
HPA039504-100ul |
|
|
|
|
|
HPA039504-100ul |
|
|
HPA039504-100ul |
Produktgarantie und fachkundiger Support
