Anti-MRPL57

Artikelnummer: ATA-HPA039779
Artikelname: Anti-MRPL57
Artikelnummer: ATA-HPA039779
Hersteller Artikelnummer: HPA039779
Alternativnummer: ATA-HPA039779-100,ATA-HPA039779-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MRP63
mitochondrial ribosomal protein L57
Anti-MRPL57
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 78988
UniProt: Q9BQC6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEAIKA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MRPL57
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-MRPL57 antibody. Corresponding MRPL57 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human adrenal gland shows high expression.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA039779-100ul
HPA039779-100ul
HPA039779-100ul