Anti-RAB3IP
Artikelnummer:
ATA-HPA039794
- Bilder (8)
| Artikelname: | Anti-RAB3IP |
| Artikelnummer: | ATA-HPA039794 |
| Hersteller Artikelnummer: | HPA039794 |
| Alternativnummer: | ATA-HPA039794-100,ATA-HPA039794-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RABIN3 |
| RAB3A interacting protein |
| Anti-RAB3IP |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 117177 |
| UniProt: | Q96QF0 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | AEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATITEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RAB3IP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments. |
|
|
Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in pancreatic ductal cells. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) Lane 5: Human liver tissue |
|
|
HPA039794-100ul |
|
|
|
|
|
|
|
|
HPA039794-100ul |
|
|
HPA039794-100ul |
Produktgarantie und fachkundiger Support
