Anti-TMEM72
Artikelnummer:
ATA-HPA039894
- Bilder (9)
| Artikelname: | Anti-TMEM72 |
| Artikelnummer: | ATA-HPA039894 |
| Hersteller Artikelnummer: | HPA039894 |
| Alternativnummer: | ATA-HPA039894-100,ATA-HPA039894-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA285G1.3, C10orf127, KSP37 |
| transmembrane protein 72 |
| Anti-TMEM72 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 643236 |
| UniProt: | A0PK05 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KRKKRKAAPEVLASPEQYTDPSSSAVSTTGSGDTEQTYTFHGALKEGPSSLFIHMKSILKGTKKPSA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TMEM72 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-TMEM72 antibody. Corresponding TMEM72 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, colon, kidney and lymph node using Anti-TMEM72 antibody HPA039894 (A) shows similar protein distribution across tissues to independent antibody HPA062907 (B). |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
Immunohistochemical staining of human kidney shows high expression. |
|
|
Immunohistochemical staining of human colon using Anti-TMEM72 antibody HPA039894. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TMEM72 antibody HPA039894. |
|
|
HPA039894-100ul |
|
|
HPA039894-100ul |
|
|
HPA039894-100ul |
Produktgarantie und fachkundiger Support
