Anti-CFAP54
Artikelnummer:
ATA-HPA039897
- Bilder (8)
| Artikelname: | Anti-CFAP54 |
| Artikelnummer: | ATA-HPA039897 |
| Hersteller Artikelnummer: | HPA039897 |
| Alternativnummer: | ATA-HPA039897-100,ATA-HPA039897-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C12orf55, C12orf63, FLJ31514, FLJ44112 |
| cilia and flagella associated 54 |
| Anti-CFAP54 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 144535 |
| UniProt: | Q96N23 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | CQMKEYKLALLQCYGRYLQQFNTNFDENKVDVTQFKATFFPKGFKDKTAGLTFHALSGKNMCNYQLVCDSDENLKNKESVVQCLHILSSLRLIMQVA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CFAP54 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules. |
|
|
Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-CFAP54 antibody. Corresponding CFAP54 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human placenta shows low expression as expected. |
|
|
HPA039897-100ul |
|
|
|
|
|
HPA039897-100ul |
|
|
HPA039897-100ul |
Produktgarantie und fachkundiger Support
