Anti-SLC46A3

Artikelnummer: ATA-HPA039930
Artikelname: Anti-SLC46A3
Artikelnummer: ATA-HPA039930
Hersteller Artikelnummer: HPA039930
Alternativnummer: ATA-HPA039930-100,ATA-HPA039930-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Sonstiges
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp686A1775, FLJ42613
solute carrier family 46, member 3
Anti-SLC46A3
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 283537
UniProt: Q7Z3Q1
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RRIWEETGNYTFSSDSNISECEKNKSSPIFAFQEEVQ
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC46A3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane, cytosol & actin filaments.
Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue
HPA039930-100ul
HPA039930-100ul
HPA039930-100ul