Anti-NRP2
Artikelnummer:
ATA-HPA039980
- Bilder (7)
| Artikelname: | Anti-NRP2 |
| Artikelnummer: | ATA-HPA039980 |
| Hersteller Artikelnummer: | HPA039980 |
| Alternativnummer: | ATA-HPA039980-100,ATA-HPA039980-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | VEGF165R2 |
| neuropilin 2 |
| Anti-NRP2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8828 |
| UniProt: | O60462 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NRP2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human smooth muscle shows moderate positivity. |
|
|
Immunohistochemical staining of human placenta shows moderate membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate neuropil positivity |
|
|
Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes. |
|
|
HPA039980-100ul |
|
|
HPA039980-100ul |
|
|
HPA039980-100ul |
Produktgarantie und fachkundiger Support
