Anti-GAPDH

Artikelnummer: ATA-HPA040067
Artikelname: Anti-GAPDH
Artikelnummer: ATA-HPA040067
Hersteller Artikelnummer: HPA040067
Alternativnummer: ATA-HPA040067-100,ATA-HPA040067-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GAPD
glyceraldehyde-3-phosphate dehydrogenase
Anti-GAPDH
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2597
UniProt: P04406
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GAPDH
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human stomach, lower shows strong nuclear and cytoplasmic positivity in glandular cells.
Western blot analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-GAPDH antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Western blot analysis using Anti-GAPDH antibody HPA040067 (A) shows similar pattern to independent antibody HPA061280 (B).
HPA040067-100ul
HPA040067-100ul
HPA040067-100ul