Anti-SEC24C
Artikelnummer:
ATA-HPA040196
- Bilder (9)
| Artikelname: | Anti-SEC24C |
| Artikelnummer: | ATA-HPA040196 |
| Hersteller Artikelnummer: | HPA040196 |
| Alternativnummer: | ATA-HPA040196-100,ATA-HPA040196-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0079 |
| SEC24 family member C |
| Anti-SEC24C |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9632 |
| UniProt: | P53992 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RLPSMTGPLLPGQSFGGPSVSQPNHVSSPPQALPPGTQMTGPLGPLPPMHSPQQPGYQPQQNGSFGPARGPQSNYGGPYPAAPTF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SEC24C |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human stomach, lower shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines PC-3 and HeLa using Anti-SEC24C antibody. Corresponding SEC24C RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
Western blot analysis using Anti-SEC24C antibody HPA040196 (A) shows similar pattern to independent antibody HPA040213 (B). |
|
|
|
|
|
|
|
|
HPA040196-100ul |
|
|
HPA040196-100ul |
|
|
HPA040196-100ul |
Produktgarantie und fachkundiger Support
