Anti-KLF5
Artikelnummer:
ATA-HPA040398
- Bilder (7)
| Artikelname: | Anti-KLF5 |
| Artikelnummer: | ATA-HPA040398 |
| Hersteller Artikelnummer: | HPA040398 |
| Alternativnummer: | ATA-HPA040398-100,ATA-HPA040398-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ChIP, ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BTEB2, CKLF, IKLF |
| Kruppel-like factor 5 (intestinal) |
| Anti-KLF5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 688 |
| UniProt: | Q13887 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TYTMPSQFLPQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYCDYPGCTK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KLF5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles. |
|
|
Immunohistochemical staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell line RT-4. |
|
|
HPA040398-100ul |
|
|
|
|
|
HPA040398-100ul |
|
|
HPA040398-100ul |
Produktgarantie und fachkundiger Support
