Anti-ADO
Artikelnummer:
ATA-HPA040437
- Bilder (8)
| Artikelname: | Anti-ADO |
| Artikelnummer: | ATA-HPA040437 |
| Hersteller Artikelnummer: | HPA040437 |
| Alternativnummer: | ATA-HPA040437-100,ATA-HPA040437-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C10orf22, FLJ14547 |
| 2-aminoethanethiol (cysteamine) dioxygenase |
| Anti-ADO |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 84890 |
| UniProt: | Q96SZ5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GASDRDAASGPEAPMQPGFPENLSKLKSLLTQLRAEDLNIAPRKATLQPL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ADO |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemistry analysis in human testis and liver tissues using HPA040437 antibody. Corresponding ADO RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human smooth muscle shows moderate positivity. |
|
|
Immunohistochemical staining of human cerebral cortex shows strong positivity in neurons. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in Leydig cells. |
|
|
HPA040437-100ul |
|
|
HPA040437-100ul |
|
|
HPA040437-100ul |
Produktgarantie und fachkundiger Support
