Anti-WDFY4
Artikelnummer:
ATA-HPA040634
- Bilder (9)
| Artikelname: | Anti-WDFY4 |
| Artikelnummer: | ATA-HPA040634 |
| Hersteller Artikelnummer: | HPA040634 |
| Alternativnummer: | ATA-HPA040634-100,ATA-HPA040634-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C10orf64, Em:AC060234.3, FLJ45748, KIAA1607 |
| WDFY family member 4 |
| Anti-WDFY4 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 57705 |
| UniProt: | Q6ZS81 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VMDNLKSQSPLPEQSPCLLPGFRVLNDFLAHHVHIPEVYLIVSTFFLQTPLTELMDGPKDSLDAMLQWLLQRHHQEEVLQAGLCTEGALLLLEM |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | WDFY4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cytosol. |
|
|
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells. |
|
|
HPA040634-100ul |
|
|
|
|
|
HPA040634-100ul |
|
|
HPA040634-100ul |
Produktgarantie und fachkundiger Support
