Anti-GNAO1

Artikelnummer: ATA-HPA040878
Artikelname: Anti-GNAO1
Artikelnummer: ATA-HPA040878
Hersteller Artikelnummer: HPA040878
Alternativnummer: ATA-HPA040878-100,ATA-HPA040878-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: G-ALPHA-o
guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
Anti-GNAO1
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 2775
UniProt: P09471
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: GNAO1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-GNAO1 antibody. Corresponding GNAO1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human Cerebral Cortex tissue
HPA040878-100ul
HPA040878-100ul
HPA040878-100ul