Anti-ACSS1
Artikelnummer:
ATA-HPA041014
- Bilder (8)
| Artikelname: | Anti-ACSS1 |
| Artikelnummer: | ATA-HPA041014 |
| Hersteller Artikelnummer: | HPA041014 |
| Alternativnummer: | ATA-HPA041014-100,ATA-HPA041014-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ACAS2L, AceCS2L, dJ568C11.3, MGC33843 |
| acyl-CoA synthetase short-chain family member 1 |
| Anti-ACSS1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 84532 |
| UniProt: | Q9NUB1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | IFAGFSAESLAGRINDAKCKVVITFNQGLRGGRVVELKKIVDEAVKHCPTVQHVLVAHRTDNKVHMGDLDVPLEQEMAKEDPVCAPESMGSEDMLFML |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ACSS1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human placenta and liver tissues using Anti-ACSS1 antibody. Corresponding ACSS1 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human placenta shows high expression. |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA041014-100ul |
|
|
|
|
|
HPA041014-100ul |
|
|
HPA041014-100ul |
Produktgarantie und fachkundiger Support
