Anti-FAM92B
Artikelnummer:
ATA-HPA041022
- Bilder (8)
| Artikelname: | Anti-FAM92B |
| Artikelnummer: | ATA-HPA041022 |
| Hersteller Artikelnummer: | HPA041022 |
| Alternativnummer: | ATA-HPA041022-100,ATA-HPA041022-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ44299 |
| family with sequence similarity 92, member B |
| Anti-FAM92B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.7 mg/ml |
| Isotyp: | IgG |
| NCBI: | 339145 |
| UniProt: | Q6ZTR7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TLEKYDLERDLLDFRAKMQGVYGHYDTRLLANTSPPPSVLQSLASQGTLQVQLSRANEDPEHPHANHGRFSLCEWVVKGQPAHCVCGQGG |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM92B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:5000 - 1:10000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-FAM92B antibody. Corresponding FAM92B RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows low expression as expected. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and FAM92B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403680). |
|
|
HPA041022-100ul |
|
|
|
|
|
HPA041022-100ul |
|
|
HPA041022-100ul |
Produktgarantie und fachkundiger Support
