Anti-TRPM4
Artikelnummer:
ATA-HPA041169
- Bilder (8)
| Artikelname: | Anti-TRPM4 |
| Artikelnummer: | ATA-HPA041169 |
| Hersteller Artikelnummer: | HPA041169 |
| Alternativnummer: | ATA-HPA041169-100,ATA-HPA041169-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20041 |
| transient receptor potential cation channel, subfamily M, member 4 |
| Anti-TRPM4 |
| Klonalität: | Polyclonal |
| Konzentration: | 1.0 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54795 |
| UniProt: | Q8TD43 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLLVAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQVERIMTRKE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TRPM4 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & plasma membrane. |
|
|
Immunohistochemistry analysis in human prostate and lymph node tissues using Anti-TRPM4 antibody. Corresponding TRPM4 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human prostate shows high expression. |
|
|
Immunohistochemical staining of human lymph node shows low expression as expected. |
|
|
HPA041169-100ul |
|
|
|
|
|
HPA041169-100ul |
|
|
HPA041169-100ul |
Produktgarantie und fachkundiger Support
