Anti-DNAJC17
Artikelnummer:
ATA-HPA041187
- Bilder (4)
| Artikelname: | Anti-DNAJC17 |
| Artikelnummer: | ATA-HPA041187 |
| Hersteller Artikelnummer: | HPA041187 |
| Alternativnummer: | ATA-HPA041187-100,ATA-HPA041187-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Molekularbiologie |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ10634 |
| DnaJ (Hsp40) homolog, subfamily C, member 17 |
| Anti-DNAJC17 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55192 |
| UniProt: | Q9NVM6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NPRAAELFHQLSQALEVLTDAAARAAYDKVRKAKKQAAERTQKLDEKRKKVKLDLEARERQAQAQES |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DNAJC17 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
Western blot analysis using Anti-DNAJC17 antibody HPA041187 (A) shows similar pattern to independent antibody HPA040914 (B). |
|
|
HPA041187-100ul |
|
|
HPA041187-100ul |
Produktgarantie und fachkundiger Support
