Anti-OAS3

Artikelnummer: ATA-HPA041253
Artikelname: Anti-OAS3
Artikelnummer: ATA-HPA041253
Hersteller Artikelnummer: HPA041253
Alternativnummer: ATA-HPA041253-100,ATA-HPA041253-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: OAS3
2-5-oligoadenylate synthetase 3, 100kDa
Anti-OAS3
Klonalität: Polyclonal
Konzentration: 0.6 mg/ml
Isotyp: IgG
NCBI: 4940
UniProt: Q9Y6K5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LKGGCDSELVIFLDCFKSYVDQRARRAEILSEMRASLESWWQNPVPGLRLTFPEQSVPGALQFRLTSVDLEDWMDVSLVPAFNVLGQAGSGVKPKPQV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: OAS3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A549 shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human breast shows moderate cytoplasmic positivity in glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA041253-100ul
HPA041253-100ul
HPA041253-100ul