Anti-CHMP4B
Artikelnummer:
ATA-HPA041401
- Bilder (8)
| Artikelname: | Anti-CHMP4B |
| Artikelnummer: | ATA-HPA041401 |
| Hersteller Artikelnummer: | HPA041401 |
| Alternativnummer: | ATA-HPA041401-100,ATA-HPA041401-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B |
| charged multivesicular body protein 4B |
| Anti-CHMP4B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.8 mg/ml |
| Isotyp: | IgG |
| NCBI: | 128866 |
| UniProt: | Q9H444 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEMLSKK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHMP4B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human liver shows weak granular cytoplasmic positivity in hepatocytes as expected. |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and CHMP4B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406132). |
|
|
HPA041401-100ul |
|
|
|
|
|
HPA041401-100ul |
|
|
HPA041401-100ul |
Produktgarantie und fachkundiger Support
