Anti-ANKS3

Artikelnummer: ATA-HPA041409
Artikelname: Anti-ANKS3
Artikelnummer: ATA-HPA041409
Hersteller Artikelnummer: HPA041409
Alternativnummer: ATA-HPA041409-100,ATA-HPA041409-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ32345, FLJ32767, KIAA1977
ankyrin repeat and sterile alpha motif domain containing 3
Anti-ANKS3
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 124401
UniProt: Q6ZW76
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: REEHAFCANLGPVQSSSSSEGLARAQGLSSEASVESNEDSDHACKSSARKQAKSYMKTKNPDSQWPPRTATDREGFLAESSPQTQRAPYSGPQD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ANKS3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemical staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
HPA041409-100ul
HPA041409-100ul
HPA041409-100ul