Anti-ENKD1

Artikelnummer: ATA-HPA041478
Artikelname: Anti-ENKD1
Artikelnummer: ATA-HPA041478
Hersteller Artikelnummer: HPA041478
Alternativnummer: ATA-HPA041478-100,ATA-HPA041478-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C16orf48, DKFZP434A1319
enkurin domain containing 1
Anti-ENKD1
Klonalität: Polyclonal
Konzentration: 1.4 mg/ml
Isotyp: IgG
NCBI: 84080
UniProt: Q9H0I2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QVLAQVLEQQRQAQEHYNATQKGHVPHYLLERRDLWRREAEARKQSQPDPAMPPGHTRMPENQRLETLTKL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: ENKD1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.
Western blot analysis in control (vector only transfected HEK293T lysate) and ENKD1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410333).
HPA041478-100ul
HPA041478-100ul
HPA041478-100ul