Anti-SLC1A6

Artikelnummer: ATA-HPA041505
Artikelname: Anti-SLC1A6
Artikelnummer: ATA-HPA041505
Hersteller Artikelnummer: HPA041505
Alternativnummer: ATA-HPA041505-100,ATA-HPA041505-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: EAAT4
solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Anti-SLC1A6
Klonalität: Polyclonal
Konzentration: 0.9 mg/ml
Isotyp: IgG
NCBI: 6511
UniProt: P48664
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SLC1A6
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500
Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments.
Immunohistochemistry analysis in human cerebral cortex and kidney tissues using Anti-SLC1A6 antibody. Corresponding SLC1A6 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human kidney shows low expression as expected.
HPA041505-100ul
HPA041505-100ul
HPA041505-100ul