Anti-FAM96B, Rabbit, Polyclonal

Artikelnummer: ATA-HPA041736
Artikelname: Anti-FAM96B, Rabbit, Polyclonal
Artikelnummer: ATA-HPA041736
Hersteller Artikelnummer: HPA041736
Alternativnummer: ATA-HPA041736-100,ATA-HPA041736-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CGI-128
family with sequence similarity 96, member B
Anti-FAM96B
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 51647
UniProt: Q9Y3D0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SMATLIGLSIKVKLLRSLPQRFKMDVHITPGTHASEHAVNKQLADKERVA
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human testis shows moderate cytoplasmic positivity.
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.