Anti-KNSTRN
Artikelnummer:
ATA-HPA042027
- Bilder (8)
| Artikelname: | Anti-KNSTRN |
| Artikelnummer: | ATA-HPA042027 |
| Hersteller Artikelnummer: | HPA042027 |
| Alternativnummer: | ATA-HPA042027-100,ATA-HPA042027-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C15orf23, FLJ14502, kinastrin, SKAP, TRAF4AF1 |
| kinetochore-localized astrin/SPAG5 binding protein |
| Anti-KNSTRN |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 90417 |
| UniProt: | Q9Y448 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITKLRRENGQMKATDTATRRNVRKGYKPLSKQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | KNSTRN |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubules. |
|
|
Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human pancreas shows no positivity in exocrine glandular cells as expected. |
|
|
Western blot analysis in human cell lines A-431 and SK-MEL-30 using Anti-KNSTRN antibody. Corresponding KNSTRN RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1. |
|
|
HPA042027-100ul |
|
|
|
|
|
HPA042027-100ul |
|
|
HPA042027-100ul |
Produktgarantie und fachkundiger Support
