Anti-TREH
Artikelnummer:
ATA-HPA042045
- Bilder (8)
| Artikelname: | Anti-TREH |
| Artikelnummer: | ATA-HPA042045 |
| Hersteller Artikelnummer: | HPA042045 |
| Alternativnummer: | ATA-HPA042045-100,ATA-HPA042045-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | MGC129621, TRE, TREA |
| trehalase (brush-border membrane glycoprotein) |
| Anti-TREH |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 11181 |
| UniProt: | O43280 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | ALNTVLWDEQTGAWFDYDLEKKKKNREFYPSNLTPLWAGCFSDPGVADKALKYLEDNRILTYQYGIPTSLQKTGQQWDFPNAWAPLQDLVIR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | TREH |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000 |
|
|
Immunohistochemical staining of human cerebral cortex, duodenum, kidney and testis using Anti-TREH antibody HPA042045 (A) shows similar protein distribution across tissues to independent antibody HPA039913 (B). |
|
|
Immunohistochemical staining of human duodenum using Anti-TREH antibody HPA042045. |
|
|
Immunohistochemical staining of human kidney using Anti-TREH antibody HPA042045. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-TREH antibody HPA042045. |
|
|
Immunohistochemical staining of human testis using Anti-TREH antibody HPA042045. |
|
|
HPA042045-100ul |
|
|
HPA042045-100ul |
|
|
HPA042045-100ul |
Produktgarantie und fachkundiger Support
