Anti-ITIH1
Artikelnummer:
ATA-HPA042049
- Bilder (8)
| Artikelname: | Anti-ITIH1 |
| Artikelnummer: | ATA-HPA042049 |
| Hersteller Artikelnummer: | HPA042049 |
| Alternativnummer: | ATA-HPA042049-100,ATA-HPA042049-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | H1P, IATIH, ITIH |
| inter-alpha-trypsin inhibitor heavy chain 1 |
| Anti-ITIH1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3697 |
| UniProt: | P19827 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQK |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | ITIH1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles. |
|
|
Immunohistochemical staining of human colon shows distinct positivity in extracellular material. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) |
|
|
HPA042049-100ul |
|
|
|
|
|
|
|
|
HPA042049-100ul |
|
|
HPA042049-100ul |
Produktgarantie und fachkundiger Support
