Anti-PPP1R14A
Artikelnummer:
ATA-HPA042097
- Bilder (8)
| Artikelname: | Anti-PPP1R14A |
| Artikelnummer: | ATA-HPA042097 |
| Hersteller Artikelnummer: | HPA042097 |
| Alternativnummer: | ATA-HPA042097-100,ATA-HPA042097-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CPI-17, PPP1INL |
| protein phosphatase 1, regulatory (inhibitor) subunit 14A |
| Anti-PPP1R14A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 94274 |
| UniProt: | Q96A00 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VKYDRRELQRRLDVEKWIDGRLEELYRGMEADMPDEINIDELLELESEEERSR |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PPP1R14A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human cerebral cortex and skin tissues using Anti-PPP1R14A antibody. Corresponding PPP1R14A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows high expression. |
|
|
Immunohistochemical staining of human skin shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line A-549 |
|
|
HPA042097-100ul |
|
|
|
|
|
HPA042097-100ul |
|
|
HPA042097-100ul |
Produktgarantie und fachkundiger Support
