Anti-HSD17B8

Artikelnummer: ATA-HPA042132
Artikelname: Anti-HSD17B8
Artikelnummer: ATA-HPA042132
Hersteller Artikelnummer: HPA042132
Alternativnummer: ATA-HPA042132-100,ATA-HPA042132-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: D6S2245E, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1
hydroxysteroid (17-beta) dehydrogenase 8
Anti-HSD17B8
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Isotyp: IgG
NCBI: 7923
UniProt: Q92506
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: HSD17B8
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human parathyroid gland and testis tissues using Anti-HSD17B8 antibody. Corresponding HSD17B8 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows low expression as expected.
Immunohistochemical staining of human parathyroid gland shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and HSD17B8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY415425).
HPA042132-100ul
HPA042132-100ul
HPA042132-100ul