Anti-NDUFA9

Artikelnummer: ATA-HPA042268
Artikelname: Anti-NDUFA9
Artikelnummer: ATA-HPA042268
Hersteller Artikelnummer: HPA042268
Alternativnummer: ATA-HPA042268-100
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CI-39k, NDUFS2L, SDR22E1
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa
Anti-NDUFA9
Klonalität: Polyclonal
Konzentration: 0.05 mg/ml
Isotyp: IgG
NCBI: 4704
UniProt: Q16795
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: RVLSMSRSAITAIATSVCHGPPCRQLHHALMPHGKGGRSSVSGIVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDKYDIMHLRPMGDLGQLLFLEWDARDKDSIRRVVQHSNVVINLIGRDWETKNFDFEDVFVKIPQAI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NDUFA9
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human small intestine and pancreas tissues using Anti-NDUFA9 antibody. Corresponding NDUFA9 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human small intestine shows high expression.
Western blot analysis in control (vector only transfected HEK293T lysate) and NDUFA9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401557).
HPA042268-100ul
HPA042268-100ul
HPA042268-100ul