Anti-MIEF2

Artikelnummer: ATA-HPA042334
Artikelname: Anti-MIEF2
Artikelnummer: ATA-HPA042334
Hersteller Artikelnummer: HPA042334
Alternativnummer: ATA-HPA042334-100,ATA-HPA042334-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC23130, MiD49, SMCR7
mitochondrial elongation factor 2
Anti-MIEF2
Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 125170
UniProt: Q96C03
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PPAALSQPVLPLAPSSSAPEGPAETDPEVTPQLSSPAPLCLTLQERLLAFERDRVTIPAAQVALAKQLAGDIALELQAYFRSKFPELPFGAFVPGGPLYDGLQAGAADHVRLL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: MIEF2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Immunohistochemical staining of human skin shows moderate cytoplasmic positivity in epidermal cells.
Immunohistochemical staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
HPA042334-100ul
HPA042334-100ul
HPA042334-100ul