Anti-PRL
Artikelnummer:
ATA-HPA042416
- Bilder (8)
| Artikelname: | Anti-PRL |
| Artikelnummer: | ATA-HPA042416 |
| Hersteller Artikelnummer: | HPA042416 |
| Alternativnummer: | ATA-HPA042416-100,ATA-HPA042416-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PRL |
| prolactin |
| Anti-PRL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5617 |
| UniProt: | P01236 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | TEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNN |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemical staining of human cerebral cortex, liver, lymph node and pituitary gland using Anti-PRL antibody HPA042416 (A) shows similar protein distribution across tissues to independent antibody HPA062017 (B). |
|
|
Immunohistochemical staining of human pituitary gland using Anti-PRL antibody HPA042416. |
|
|
Immunohistochemical staining of human lymph node using Anti-PRL antibody HPA042416. |
|
|
Immunohistochemical staining of human liver using Anti-PRL antibody HPA042416. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-PRL antibody HPA042416. |
|
|
HPA042416-100ul |
|
|
HPA042416-100ul |
|
|
HPA042416-100ul |
Produktgarantie und fachkundiger Support
