Anti-GAPDHS
Artikelnummer:
ATA-HPA042666
- Bilder (8)
| Artikelname: | Anti-GAPDHS |
| Artikelnummer: | ATA-HPA042666 |
| Hersteller Artikelnummer: | HPA042666 |
| Alternativnummer: | ATA-HPA042666-100,ATA-HPA042666-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GAPD2, GAPDH-2, GAPDS |
| glyceraldehyde-3-phosphate dehydrogenase, spermatogenic |
| Anti-GAPDHS |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 26330 |
| UniProt: | O14556 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | GAPDHS |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500 |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. |
|
|
Immunohistochemistry analysis in human testis and kidney tissues using Anti-GAPDHS antibody. Corresponding GAPDHS RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human testis shows high expression. |
|
|
Immunohistochemical staining of human kidney shows low expression as expected. |
|
|
HPA042666-100ul |
|
|
|
|
|
HPA042666-100ul |
|
|
HPA042666-100ul |
Produktgarantie und fachkundiger Support
