Anti-SRRT

Artikelnummer: ATA-HPA042858
Artikelname: Anti-SRRT
Artikelnummer: ATA-HPA042858
Hersteller Artikelnummer: HPA042858
Alternativnummer: ATA-HPA042858-100,ATA-HPA042858-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: ARS2, Asr2, serrate
serrate, RNA effector molecule
Anti-SRRT
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 51593
UniProt: Q9BXP5
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TCSLFMRNIAPNISRAEIISLCKRYPGFMRVALSEPQPERRFFRRGWVTFDRSVNIKEICWNLQNIRLRECELSPGVNRDLTRRVRNINGITQHKQI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SRRT
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
Western blot analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SRRT antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
HPA042858-100ul
HPA042858-100ul
HPA042858-100ul