Anti-RC3H2
Artikelnummer:
ATA-HPA042863
- Bilder (8)
| Artikelname: | Anti-RC3H2 |
| Artikelnummer: | ATA-HPA042863 |
| Hersteller Artikelnummer: | HPA042863 |
| Alternativnummer: | ATA-HPA042863-100,ATA-HPA042863-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ20301, FLJ20713, MNAB, RNF164 |
| ring finger and CCCH-type domains 2 |
| Anti-RC3H2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 54542 |
| UniProt: | Q9HBD1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | GAISRSSRTGYHTTDPVQATASQGSATKPISVSDYVPYVNAVDSRWSSYGNEATSSAHYVERDRFIVTDLSGHRKHSSTGDLLSLELQQAKSNSLLLQ |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RC3H2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HeLa shows localization to vesicles. |
|
|
Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp Lane 4: Human plasma (IgG/HSA depleted) |
|
|
|
|
|
|
|
|
HPA042863-100ul |
|
|
HPA042863-100ul |
|
|
HPA042863-100ul |
Produktgarantie und fachkundiger Support
