Anti-CHMP5
Artikelnummer:
ATA-HPA042883
- Bilder (8)
| Artikelname: | Anti-CHMP5 |
| Artikelnummer: | ATA-HPA042883 |
| Hersteller Artikelnummer: | HPA042883 |
| Alternativnummer: | ATA-HPA042883-100,ATA-HPA042883-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | C9orf83, CGI-34, HSPC177, SNF7DC2, Vps60 |
| charged multivesicular body protein 5 |
| Anti-CHMP5 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51510 |
| UniProt: | Q9NZZ3 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHMP5 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemical staining of human colon, kidney, liver and lymph node using Anti-CHMP5 antibody HPA042883 (A) shows similar protein distribution across tissues to independent antibody HPA056437 (B). |
|
|
Immunohistochemical staining of human kidney using Anti-CHMP5 antibody HPA042883. |
|
|
Immunohistochemical staining of human lymph node using Anti-CHMP5 antibody HPA042883. |
|
|
Immunohistochemical staining of human liver using Anti-CHMP5 antibody HPA042883. |
|
|
Immunohistochemical staining of human colon using Anti-CHMP5 antibody HPA042883. |
|
|
HPA042883-100ul |
|
|
HPA042883-100ul |
|
|
HPA042883-100ul |
Produktgarantie und fachkundiger Support
