Anti-IRAK3 Antibody , Unconjugated, Rabbit, Polyclonal

Artikelnummer: ATA-HPA043097
Artikelname: Anti-IRAK3 Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer: ATA-HPA043097
Hersteller Artikelnummer: HPA043097
Alternativnummer: ATA-HPA043097-100,ATA-HPA043097-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: IRAK-M
interleukin-1 receptor-associated kinase 3

Anti-IRAK3

Klonalität: Polyclonal
Isotyp: IgG
NCBI: 11213
UniProt: Q9Y616
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: SWLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGE
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: IRAK3
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line SiHa shows localization to vesicles.
Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in germinal and non germinal center cells.
Immunohistochemical staining of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemical staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemical staining of human gastrointestinal shows strong cytoplasmic positivity in peripheral leukocytes.
Western blot analysis in control (vector only transfected HEK293T lysate) and IRAK3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402105).
HPA043097
HPA043097
HPA043097