Anti-CLINT1
Artikelnummer:
ATA-HPA043280
- Bilder (9)
| Artikelname: | Anti-CLINT1 |
| Artikelnummer: | ATA-HPA043280 |
| Hersteller Artikelnummer: | HPA043280 |
| Alternativnummer: | ATA-HPA043280-100,ATA-HPA043280-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CLINT, ENTH, EPNR, KIAA0171 |
| clathrin interactor 1 |
| Anti-CLINT1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 9685 |
| UniProt: | Q14677 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DEEETVTTKHIHITQATETTTTRHKRTANPSKTIDLGAAAHYTGDKASPDQNASTHTPQSSVKTSVPSSKSSGDLVDLFDGTSQSTGGSADLFGGFADFGS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CLINT1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles. |
|
|
Immunohistochemical staining of human colon shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-CLINT1 antibody HPA043280 (A) shows similar pattern to independent antibody HPA056947 (B). |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA043280-100ul |
|
|
|
|
|
|
|
|
HPA043280-100ul |
|
|
HPA043280-100ul |
Produktgarantie und fachkundiger Support
