Anti-FAM3C
Artikelnummer:
ATA-HPA043376
- Bilder (8)
| Artikelname: | Anti-FAM3C |
| Artikelnummer: | ATA-HPA043376 |
| Hersteller Artikelnummer: | HPA043376 |
| Alternativnummer: | ATA-HPA043376-100,ATA-HPA043376-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GS3876, ILEI |
| family with sequence similarity 3, member C |
| Anti-FAM3C |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10447 |
| UniProt: | Q92520 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM3C |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200 |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus. |
|
|
Immunohistochemical staining of human duodenum shows positivity in glandular cells. |
|
|
Immunohistochemical staining of human cerebral cortex shows positivity in neurons. |
|
|
Immunohistochemical staining of human placenta shows positivity in trophoblastic cells. |
|
|
|
|
|
HPA043376-100ul |
|
|
HPA043376-100ul |
|
|
HPA043376-100ul |
Produktgarantie und fachkundiger Support
