Anti-NFE2L2, Rabbit, Polyclonal

Artikelnummer: ATA-HPA043438
Artikelname: Anti-NFE2L2, Rabbit, Polyclonal
Artikelnummer: ATA-HPA043438
Hersteller Artikelnummer: HPA043438
Alternativnummer: ATA-HPA043438-100,ATA-HPA043438-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: NRF2
nuclear factor, erythroid 2-like 2
Anti-NFE2L2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 4780
UniProt: Q16236
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: QKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGMQQDIEQVWEELLSIPELQCL
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, cytosol & centrosome.