Anti-NOSIP
Artikelnummer:
ATA-HPA043464
- Bilder (8)
| Artikelname: | Anti-NOSIP |
| Artikelnummer: | ATA-HPA043464 |
| Hersteller Artikelnummer: | HPA043464 |
| Alternativnummer: | ATA-HPA043464-100,ATA-HPA043464-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGI-25 |
| nitric oxide synthase interacting protein |
| Anti-NOSIP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 51070 |
| UniProt: | Q9Y314 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RHGKNCTAGAVYTYHEKKKDTAASGYGTQNIRLSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQMKAYEKQRGT |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | NOSIP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human esophagus shows moderate cytoplasmic and nuclear positivity in squamous epithelial cells. |
|
|
Western blot analysis using Anti-NOSIP antibody HPA043464 (A) shows similar pattern to independent antibody HPA062132 (B). |
|
|
HPA043464-100ul |
|
|
|
|
|
|
|
|
HPA043464-100ul |
|
|
HPA043464-100ul |
Produktgarantie und fachkundiger Support
