Anti-SAE1

Artikelnummer: ATA-HPA043552
Artikelname: Anti-SAE1
Artikelnummer: ATA-HPA043552
Hersteller Artikelnummer: HPA043552
Alternativnummer: ATA-HPA043552-100,ATA-HPA043552-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: AOS1, FLJ3091, Sua1
SUMO1 activating enzyme subunit 1
Anti-SAE1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 10055
UniProt: Q9UBE0
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRD
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SAE1
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:1000 - 1:2500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SAE1 antibody. Corresponding SAE1 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows high expression.
Immunohistochemical staining of human pancreas shows low expression as expected.
Western blot analysis using Anti-SAE1 antibody HPA043552 (A) shows similar pattern to independent antibody HPA041906 (B).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
HPA043552-100ul
HPA043552-100ul
HPA043552-100ul