Anti-RBM12

Artikelnummer: ATA-HPA043621
Artikelname: Anti-RBM12
Artikelnummer: ATA-HPA043621
Hersteller Artikelnummer: HPA043621
Alternativnummer: ATA-HPA043621-100,ATA-HPA043621-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: HRIHFB2091, KIAA0765, SWAN
RNA binding motif protein 12
Anti-RBM12
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 10137
UniProt: Q9NTZ6
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NMIELSRRRFETANLDIPPANASRSGPPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVGTAPPNMGASFGSPTFSSTVPST
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: RBM12
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human lymph node shows nuclear positivity in germinal and non germinal center.
Western blot analysis using Anti-RBM12 antibody HPA043621 (A) shows similar pattern to independent antibody HPA043258 (B).
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
HPA043621-100ul
HPA043621-100ul
HPA043621-100ul