Anti-SPATA5L1

Artikelnummer: ATA-HPA043679
Artikelname: Anti-SPATA5L1
Artikelnummer: ATA-HPA043679
Hersteller Artikelnummer: HPA043679
Alternativnummer: ATA-HPA043679-100,ATA-HPA043679-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: FLJ12286, MGC5347
spermatogenesis associated 5-like 1
Anti-SPATA5L1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 79029
UniProt: Q9BVQ7
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: TSCHCSFVSVSGADLFSPFVGDSEKVLSQIFRQARASTPAILFLDEIDSILGARSASKTGCDVQERVLSVLLNELDGVGLKTIERRGSKSSQQEFQEV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: SPATA5L1
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemical staining of human pancreas shows moderate cytoplasmic positivity in exocrine glandular cells.
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
HPA043679-100ul
HPA043679-100ul
HPA043679-100ul