Anti-PSMA1
Artikelnummer:
ATA-HPA043891
- Bilder (6)
| Artikelname: | Anti-PSMA1 |
| Artikelnummer: | ATA-HPA043891 |
| Hersteller Artikelnummer: | HPA043891 |
| Alternativnummer: | ATA-HPA043891-100 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | HC2, MGC14542, MGC14575, MGC14751, MGC1667, MGC21459, MGC22853, MGC23915, NU, PROS30 |
| proteasome (prosome, macropain) subunit, alpha type, 1 |
| Anti-PSMA1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5682 |
| UniProt: | P25786 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PSMA1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:20 - 1:50, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferus ducts and Leydig cells. |
|
|
Western blot analysis using Anti-PSMA1 antibody HPA043891 (A) shows similar pattern to independent antibody HPA037646 (B). |
|
|
HPA043891-100ul |
|
|
HPA043891-100ul |
|
|
HPA043891-100ul |
Produktgarantie und fachkundiger Support
