Anti-BPIFA2
Artikelnummer:
ATA-HPA044006
- Bilder (6)
| Artikelname: | Anti-BPIFA2 |
| Artikelnummer: | ATA-HPA044006 |
| Hersteller Artikelnummer: | HPA044006 |
| Alternativnummer: | ATA-HPA044006-100,ATA-HPA044006-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | bA49G10.1, C20orf70, PSP, SPLUNC2 |
| BPI fold containing family A, member 2 |
| Anti-BPIFA2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 140683 |
| UniProt: | Q96DR5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | VDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNTDIFGLKISNSLILDVKAEPIDDGKGLNLSFPVTANVTVAGPIIGQII |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BPIFA2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human salivary gland and duodenum tissues using Anti-BPIFA2 antibody. Corresponding BPIFA2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human salivary gland shows high expression. |
|
|
Immunohistochemical staining of human duodenum shows low expression as expected. |
|
|
HPA044006-100ul |
|
|
HPA044006-100ul |
|
|
HPA044006-100ul |
Produktgarantie und fachkundiger Support
