Anti-VAT1L
Artikelnummer:
ATA-HPA044061
- Bilder (6)
| Artikelname: | Anti-VAT1L |
| Artikelnummer: | ATA-HPA044061 |
| Hersteller Artikelnummer: | HPA044061 |
| Alternativnummer: | ATA-HPA044061-100,ATA-HPA044061-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | ICC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA1576 |
| vesicle amine transport 1-like |
| Anti-VAT1L |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 57687 |
| UniProt: | Q9HCJ6 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | VAT1L |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. |
|
|
Western blot analysis in human cell line U-87 MG. |
|
|
Western blot analysis in control (vector only transfected HEK293T lysate) and VAT1L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412225). |
|
|
HPA044061-100ul |
|
|
HPA044061-100ul |
|
|
HPA044061-100ul |
Produktgarantie und fachkundiger Support
